PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG005336t1
Common NameTCM_005336
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family BES1
Protein Properties Length: 702aa    MW: 78621.9 Da    PI: 5.3423
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG005336t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822147.89.1e-46762161134
            DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyr...kgskpl.eeaeaagssas.. 87 
                       gg++r+++ +E+E++k+RER+RRai+a+i+aGLR++Gny+l++raD+n+V++AL+reAGwvv +DGtt++   +gs+p   +++ + ss+s  
  Thecc1EG005336t1  76 GGARRSRPLEEKERTKLRERHRRAITARILAGLRRHGNYNLRVRADINDVIAALAREAGWVVLPDGTTFPsrsQGSRPAaGTSAGMTSSSSqm 168
                       6899*****************************************************************987888999864444444444423 PP

            DUF822  88 aspesslq.sslkssalaspvesysaspksssfpspssldsislasaa 134
                       +s+ ++ + ++ +ss  ++ v+  ++++k + +p ps +d  s+a ++
  Thecc1EG005336t1 169 VSQPTPPTsLRGVSSGYRTSVDYNACRMKGVFMPTPSPYDLSSSARSQ 216
                       4555555557889***************************98876543 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.0E-3978214IPR008540BES1/BZR1 plant transcription factor, N-terminal
SuperFamilySSF514453.04E-183258697IPR017853Glycoside hydrolase superfamily
Gene3DG3DSA:3.20.20.807.4E-201261695IPR013781Glycoside hydrolase, catalytic domain
PfamPF013731.3E-103267687IPR001554Glycoside hydrolase, family 14
PRINTSPR007509.3E-69298312IPR001554Glycoside hydrolase, family 14
PRINTSPR007509.3E-69319337IPR001554Glycoside hydrolase, family 14
PRINTSPR007509.3E-69341362IPR001554Glycoside hydrolase, family 14
PROSITE patternPS005060345353IPR018238Glycoside hydrolase, family 14, conserved site
PRINTSPR008425.4E-9424433IPR001371Glycoside hydrolase, family 14B, plant
PRINTSPR007509.3E-69434456IPR001554Glycoside hydrolase, family 14
PRINTSPR007509.3E-69507526IPR001554Glycoside hydrolase, family 14
PRINTSPR007509.3E-69541557IPR001554Glycoside hydrolase, family 14
PRINTSPR007509.3E-69558569IPR001554Glycoside hydrolase, family 14
PRINTSPR007509.3E-69576599IPR001554Glycoside hydrolase, family 14
PRINTSPR008425.4E-9579589IPR001371Glycoside hydrolase, family 14B, plant
PRINTSPR007509.3E-69616638IPR001554Glycoside hydrolase, family 14
PRINTSPR008425.4E-9667681IPR001371Glycoside hydrolase, family 14B, plant
PRINTSPR008425.4E-9682696IPR001371Glycoside hydrolase, family 14B, plant
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000272Biological Processpolysaccharide catabolic process
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048831Biological Processregulation of shoot system development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0016161Molecular Functionbeta-amylase activity
Sequence ? help Back to Top
Protein Sequence    Length: 702 aa     Download sequence    Send to blast
MATDMQKLIG ASEEDDEEEM EMDVKEEDDE DEENGEKHIA AQMMMGVDGV MQSTSSSGQF  60
QHHQQLQEQV STPGGGGARR SRPLEEKERT KLRERHRRAI TARILAGLRR HGNYNLRVRA  120
DINDVIAALA REAGWVVLPD GTTFPSRSQG SRPAAGTSAG MTSSSSQMVS QPTPPTSLRG  180
VSSGYRTSVD YNACRMKGVF MPTPSPYDLS SSARSQSSGM VGDGGEQTES LPLIAGSMEA  240
VNNKQVIDLP PKLPEHDFAG TPYVPVYVML PLGIINMKCE LIDPDGLLKQ LRALKSINVD  300
GVMVDCWWGI VEAHAPLEYN WNGYRRLFQM VRELKLKIQV VMSFHECGGN VGDDVCIPLP  360
HWVAEIGRSN PDMFFTDREG RRNPECLSWG IDKERVLRGR TAVEVYFDYM RSFRVEFNEF  420
FEDGIISMVE VGLGPCGELR YPSCPVKHGW RYPGIGEFQC YDQYMSKSLR KAAELRGHSF  480
WARGPDNAGS YNSQPDETGF FCDGGDYDGY YGRFFLNWYS QVLVDHGDRV LSLAKLAFEG  540
TCIAAKLPGI QWWYKTASHA AELTAGFYNP CNRDGYSAIA AMLHKHGATL NFACPELHLL  600
EQHEDLREAL ADPQGLVWQV LNAAWDVCIP VASENALLCH DRMGYNKILD NLKLVNDPDG  660
RHFASFTYLR LSPLLMERQN FMEFERFVKR MHGEAVLDLQ V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wds_A1e-15326369411444Beta-amylase
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007051814.10.0Beta-amylase 7
SwissprotO808310.0BAM7_ARATH; Beta-amylase 7
TrEMBLA0A061DV680.0A0A061DV68_THECC; Beta-amylase
STRINGVIT_15s0046g02640.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29452535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45880.10.0beta-amylase 7
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]